PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P02380_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 288aa    MW: 32051.1 Da    PI: 7.8827
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P02380_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.2e-18125179256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++tkeq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GSMUA_Achr7P02380_001 125 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 179
                            678899***********************************************98 PP

2HD-ZIP_I/II127.36.6e-41125215192
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rl+keq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+kev+eLr
  GSMUA_Achr7P02380_001 125 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCQTLTEENRRLQKEVAELR 212
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eelk 92 
                             +lk
  GSMUA_Achr7P02380_001 213 -ALK 215
                            .555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-18120182IPR009057Homeodomain-like
PROSITE profilePS5007116.779121181IPR001356Homeobox domain
SMARTSM003893.0E-15123185IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-17125179IPR009057Homeodomain-like
PfamPF000466.4E-16125179IPR001356Homeobox domain
CDDcd000866.15E-15125182No hitNo description
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
SMARTSM003402.1E-25181224IPR003106Leucine zipper, homeobox-associated
PfamPF021831.0E-10181215IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MRLVVGRGGK DEDEERRVEE EEEETEEGRG LAEAPLQLSL LPLLPVPPQQ PSSPQLRLPW  60
TTETSKNPDE KNLDASMRGF DMNHAPSAVA ADEAASSSSS PKREATTVEI GSLRVSDEEE  120
NGLGRKKLRL TKEQSAFLEE SFKEHNTLNP KQKLALAKQL NLRPRQVEVW FQNRRARTKL  180
KQTEVDCEYL RRCCQTLTEE NRRLQKEVAE LRALKTSRPF YMHVPATTLS MCPACERVAS  240
TTTIPTAPAT PSADHRPNSF AALFSKPVAL QSGSRTAPSA PRLPSPAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173181RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408401.11e-140PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotA2YW033e-83HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
SwissprotQ6YPD02e-83HOX27_ORYSJ; Homeobox-leucine zipper protein HOX27
TrEMBLM0TE280.0M0TE28_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P02380_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-59homeobox from Arabidopsis thaliana